Loading...
Statistics
Advertisement

happy animation  organizzazione eventi agenzia di animazione e ...
www.happyanimation.it/

Happyanimation.it

Advertisement
Happyanimation.it is hosted in Italy / Arezzo . Happyanimation.it doesn't use HTTPS protocol. Number of used technologies: 2. First technologies: Html, Javascript, Number of used javascripts: 0. First javascripts: Number of used analytics tools: 1. First analytics tools: ShinyStat, Its server type is: squid/3.5.9.

Technologies in use by Happyanimation.it

Technology

Number of occurences: 2
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 0

Analytics

Number of occurences: 1
  • ShinyStat

Server Type

  • squid/3.5.9

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Happyanimation.it

Missing HTTPS protocol.

    Meta - Happyanimation.it

    Number of occurences: 6
    • Name: descripiton
      Content: La happy animation è un'agenzia di animazione e servizi , per privati e per aziende feste per bambini a Napoli ed in tutta la Campania. Contattaci per Maghi , giocolieri, trampolieri , babytrucco, animatori ed animatrici, carrettino Zucchero Filato, Carrettino dei popcorn ed allestimenti di palloncini.
    • Name: keyword 2
      Content: organizzazione eventi,agenzia di animazione, festa compleanno, feste per bambini, animazione, popcorn, zucchero filato, attrazioni, mago, spettacolo, trampoliere, mangiafuoco, giochi gonfiabili, napoli, animatori,manifestazioni, servizio hostess, feste aziendali, feste per bambini, organizzazione incentive, stampa su magliette, stampa su palloncini, fiere, eventi
    • Name: keyword
      Content: animazione per bambini , animazione per adulti, trampoliere, giocoliere , sputafuoco, clown per centri commerciali, maschere disney,incentive , aziendale
    • Name: GENERATOR
      Content: Microsoft FrontPage 6.0
    • Name: ProgId
      Content: FrontPage.Editor.Document
    • Name:
      Content: text/html; charset=windows-1252

    Server / Hosting

    • IP: 31.11.33.117
    • Latitude: 43.42
    • Longitude: 11.88
    • Country: Italy
    • City: Arezzo

    Rname

    • dns.technorail.com
    • dns4.arubadns.cz
    • dns2.technorail.com
    • dns3.arubadns.net
    • mx.happyanimation.it

    Target

    • hostmaster.technorail.com

    HTTP Header Response

    HTTP/1.1 403 Forbidden Server: squid/3.5.9 Mime-Version: 1.0 Date: Thu, 19 May 2016 08:25:36 GMT Content-Type: text/html;charset=utf-8 Content-Length: 4 X-Squid-Error: ERR_ACCESS_DENIED 0 X-Cache: MISS from s_hk1 X-Cache-Lookup: NONE from s_hk1:80 Via: 1.1 s_hk1 (squid/3.5.9) Connection: keep-alive

    DNS

    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.166
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.151
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.72
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.163
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.157
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.154
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.74
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.160
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns.technorail.com
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns4.arubadns.cz
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns2.technorail.com
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns3.arubadns.net
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: SOA
    4. mname: dns.technorail.com
    5. rname: hostmaster.technorail.com
    6. serial: 1
    7. refresh: 86400
    8. retry: 7200
    9. expire: 2592000
    10. minimum-ttl: 86400
    host: happyanimation.it
    1. class: IN
    2. ttl: 21600
    3. type: MX
    4. pri: 10
    5. target: mx.happyanimation.it

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.appyanimation.it, www.heappyanimation.it, www.eappyanimation.it, www.hdappyanimation.it, www.dappyanimation.it, www.hcappyanimation.it, www.cappyanimation.it, www.huappyanimation.it, www.uappyanimation.it, www.hjappyanimation.it, www.jappyanimation.it, www.happyanimation.it, www.appyanimation.it, www.hbappyanimation.it, www.bappyanimation.it, www.hgappyanimation.it, www.gappyanimation.it, www.hppyanimation.it, www.haoppyanimation.it, www.hoppyanimation.it, www.happpyanimation.it, www.hpppyanimation.it, www.ha9ppyanimation.it, www.h9ppyanimation.it, www.happyanimation.it, www.hppyanimation.it, www.haippyanimation.it, www.hippyanimation.it, www.hauppyanimation.it, www.huppyanimation.it, www.hapyanimation.it, www.hapipyanimation.it, www.haipyanimation.it, www.hapkpyanimation.it, www.hakpyanimation.it, www.hapupyanimation.it, www.haupyanimation.it, www.hapjpyanimation.it, www.hajpyanimation.it, www.haplpyanimation.it, www.halpyanimation.it, www.hapyanimation.it, www.happiyanimation.it, www.hapiyanimation.it, www.happkyanimation.it, www.hapkyanimation.it, www.happuyanimation.it, www.hapuyanimation.it, www.happjyanimation.it, www.hapjyanimation.it, www.happlyanimation.it, www.haplyanimation.it, www.happanimation.it, www.happyzanimation.it, www.happzanimation.it, www.happyaanimation.it, www.happaanimation.it, www.happysanimation.it, www.happsanimation.it, www.happydanimation.it, www.happdanimation.it, www.happyanimation.it, www.happanimation.it, www.happycanimation.it, www.happcanimation.it, www.happy animation.it, www.happ animation.it, www.happynimation.it, www.happyaonimation.it, www.happyonimation.it, www.happyapnimation.it, www.happypnimation.it, www.happya9nimation.it, www.happy9nimation.it, www.happyanimation.it, www.happynimation.it, www.happyainimation.it, www.happyinimation.it, www.happyaunimation.it, www.happyunimation.it, www.happyaimation.it, www.happyannimation.it, www.happyanimation.it, www.happyanhimation.it, www.happyahimation.it, www.happyanjimation.it, www.happyajimation.it, www.happyankimation.it, www.happyakimation.it, www.happyanlimation.it, www.happyalimation.it, www.happyan imation.it, www.happya imation.it, www.happyanmation.it, www.happyanirmation.it, www.happyanrmation.it, www.happyanifmation.it, www.happyanfmation.it, www.happyanivmation.it, www.happyanvmation.it, www.happyanikmation.it, www.happyankmation.it, www.happyani,mation.it, www.happyan,mation.it, www.happyanibmation.it, www.happyanbmation.it, www.happyanigmation.it, www.happyangmation.it, www.happyanitmation.it, www.happyantmation.it, www.happyaniymation.it, www.happyanymation.it, www.happyaniumation.it, www.happyanumation.it, www.happyanijmation.it, www.happyanjmation.it, www.happyanimmation.it, www.happyanmmation.it, www.happyaninmation.it, www.happyannmation.it, www.happyaniation.it, www.happyanimpation.it, www.happyanipation.it, www.happyanimoation.it, www.happyanioation.it, www.happyanimiation.it, www.happyaniiation.it, www.happyanimkation.it, www.happyanikation.it, www.happyanim.ation.it, www.happyani.ation.it, www.happyanimuation.it, www.happyaniuation.it, www.happyanimjation.it, www.happyanijation.it, www.happyanimnation.it, www.happyanination.it, www.happyanim-ation.it, www.happyani-ation.it, www.happyanimtion.it, www.happyanimaotion.it, www.happyanimotion.it, www.happyanimaption.it, www.happyanimption.it, www.happyanima9tion.it, www.happyanim9tion.it, www.happyanimation.it, www.happyanimtion.it, www.happyanimaition.it, www.happyanimition.it, www.happyanimaution.it, www.happyanimution.it, www.happyanimaion.it, www.happyanimatqion.it, www.happyanimaqion.it, www.happyanimataion.it, www.happyanimaaion.it, www.happyanimat ion.it, www.happyanima ion.it, www.happyanimatwion.it, www.happyanimawion.it, www.happyanimateion.it, www.happyanimaeion.it, www.happyanimatzion.it, www.happyanimazion.it, www.happyanimatxion.it, www.happyanimaxion.it, www.happyanimatcion.it, www.happyanimacion.it,

    Other websites we recently analyzed

    1. Psychiatry Port Orange, Florida
      Psychiatrist, Psychiatry, Therapy, Counseling, Psychotherapy, Depression, Anxiety, ADHD, Obsessive Compulsive Disorder, Stress Management, OCD, PTSD
      Ashburn (United States) - 54.236.189.61
      G Analytics ID: UA-49148900-1
      Server software: openresty/1.7.4.1
      Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Google Analytics
      Number of Javascript: 10
      Number of meta tags: 4
    2. keechains.org
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    3. kellerwilliamsrealtyservices.com
      Chicago (United States) - 184.154.247.147
      Server software: nginx
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, Shortcodes, Wordpress
      Number of Javascript: 22
      Number of meta tags: 3
    4. Julian Scheffer
      Julian Scheffer - I am currently pursuing a Ph.D. in Social Psychology at the Pennsylvania State University. I completed my undergrad at the University of Toronto where I obtained a Hon. B.Sc in Neuroscience and Psychology.
      San Francisco (United States) - 104.18.48.189
      G Analytics ID: UA-64569494-2
      Server software: cloudflare-nginx
      Technology: CSS, Html, Html5, Javascript, SVG, Google Analytics, Twitter Button
      Number of Javascript: 3
      Number of meta tags: 5
    5. VÃ¥gan Havnevesen KF
      Vågan havnevesens ansvarsområde omfatter hele kommunens kystlinje med tilhørende havner. Innefor havnedistriktet finnes 15 større og mindre havner med Svolvær som hovedhavn for kommunen og regionen. Andre havner med viktighet for kommunen og havnevesenet er: Digermulen, Skrova, Kabelvåg, Henningsvær, Hopen, Kleppstad, Hovsund og Laukvik.Vågan kommune ligger i et av landets viktigste områder for fiskeri og oppdrett, og er også et nasjonalt satsningsområde for turisme. Havnevesenets primære målsetning er å si
      Norway - 213.162.240.23
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of Javascript: 13
      Number of meta tags: 4
    6. psicopatologia.es
      Spain - 37.247.121.15
      Server software: Apache
      Technology: Html
    7. Welcome!
      Russian Federation - 193.124.179.237
      Server software: nginx/1.10.1
      Technology: Html, Html5, Javascript
      Number of meta tags: 1
    8. Hudson Valley Dog Walking and Pet Sitting | Serving Orange & Ulster Counties
      Dog walking and pet sitting for Orange and Ulster counties, New York.
      San Francisco (United States) - 207.198.106.171
      Server software: Apache/2.2.25 (Unix) mod_ssl/2.2.25 OpenSSL/1.0.0-fips mod_bwlimited/1.4 PHP/5.2.17
      Technology: CSS, Html, Php
      Number of meta tags: 3
    9. Stambyten och badrumsrenoveringar i Stockholm - Titania
      Vi är specialister på stambyten, renoveringar och ombyggnationer i Stockholm. När Du anlitar oss får Du en totalentreprenör som tar ansvar för hela processen.
      Sweden - 217.114.90.142
      Server software: Microsoft-IIS/5.0
      Technology: CSS, Flexslider, Html, Html5, Javascript, jQuery Colorbox, JW Player, Google Analytics, New Relic, Google +1 Button
      Number of Javascript: 23
      Number of meta tags: 11
    10. Türk Telekom Webim
      Turkey - 93.155.109.61
      Server software: LiteSpeed
      Technology: CSS, Font Awesome, Html, Javascript, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 1

    Check Other Websites